PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi04g02990.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family TCP
Protein Properties Length: 130aa    MW: 14187.2 Da    PI: 6.9435
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi04g02990.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP101.61.3e-31367973
              TCP  9 skihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73
                      ++h kv+gRdRRvRlsa caar+F+L++eLG ++d++tieWLl +a+pai ++tgt+  ++  +
  Vradi04g02990.1  3 RDRHIKVNGRDRRVRLSAICAARIFQLTRELGKKTDGETIEWLLHKAEPAIVAATGTGIVPSITS 67
                     69*******************************************************77666333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136925.081256IPR017887Transcription factor TCP subgroup
PfamPF036341.7E-27271IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 130 aa     Download sequence    Send to blast
MKRDRHIKVN GRDRRVRLSA ICAARIFQLT RELGKKTDGE TIEWLLHKAE PAIVAATGTG  60
IVPSITSSVD SAATLMANTT TTLVPLDTIA AQDTNLVTIA AVARTEQPIP PFHFDFEWMQ  120
HSDLGFCDN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150401e-164AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014496711.17e-93PREDICTED: transcription factor TCP20-like
SwissprotO646472e-30TCP9_ARATH; Transcription factor TCP9
TrEMBLA0A0S3SGP12e-84A0A0S3SGP1_PHAAN; Uncharacterized protein
STRINGVIT_08s0040g01600.t017e-31(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33393269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45680.15e-31TCP family protein